1. Conduid
  2. Scraping
  3. Reapfield
MCP server · Scraping

Reapfield

by · github.com/PedroHenriqueNS/reapfield

Scrape a URL into structured JSON from a natural-language field spec. Derives CSS selectors with an LLM once per field per domain, then replays them from cache.

Unclaimed clijsonllmmcpmcp-serverplaywrightpythonscraperweb-scraping
InstallView source
34Low

Scored 28 days ago · breakdown

About Reapfield

Reapfield is an MCP server published by PedroHenriqueNS in the Scraping category: scrape a URL into structured JSON from a natural-language field spec. Derives CSS selectors with an LLM once per field per domain, then replays them from cache.

Install

From source
git clone https://github.com/PedroHenriqueNS/reapfield

This server has no ConduID identity, so agent calls to it are not receipted. Pin the version you install and review the source before granting it credentials.

Ask AI

✦

Ask AI about Reapfield

Powered by Claude · Grounded in docs

I know everything about Reapfield. Ask me about installation, configuration, usage, or troubleshooting.

Security checks

6 checks have not been run yet.

Releases

v0.1.0v0.1.0
Questions

About Reapfield

How do I install Reapfield?

No package has been published for this server, so install it from source: clone the repository and follow its README.

Is Reapfield safe to use with an AI agent?

Its trust score is 34 out of 100 (low). Conduid hasn't run static security checks on this repository yet, so review the source yourself before granting it credentials. It has no ConduID identity yet, so agent calls to it are not receipted.

Is Reapfield still maintained?

Conduid hasn't recorded a commit date for this repository yet. Check the repository directly for recent activity.